PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G2079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 406aa    MW: 44271.1 Da    PI: 9.5927
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G2079genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.73e-14328380557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L k+ ee+ ++ +
  Gh_D02G2079 328 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNQELLKKQEEMMEMQK 380
                  79****************************************99999988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-12324389IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68326377IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-10328378No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-13328378No hitNo description
PfamPF001702.5E-12328380IPR004827Basic-leucine zipper domain
CDDcd147079.12E-27328382No hitNo description
PROSITE patternPS000360331346IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MEFIGQFDCG HNILLLWKMG SHLNFKNFGG DGNNGSKPVV NSPFVRQSSI YSLTFDELQS  60
TFGGLGKDFG SMNMDELLRN ISTAEETQSA MTASVSVGEG GDVSGGNLQK QGSLTLPRTL  120
SQKTVDEVWK YLMKESDGGS NDGSTGGEAN LPQRQQTLGT MTLEEFLARA GVVREDMQQI  180
GMVNNGGFFA DNSALALGFQ QANTNNGFAS GVKSSSQLQQ QPQPLFPKQQ VVAFAPPMHL  240
MNTTLLASPG AKGSVVGIGD PSMNNNLVQT TGLQGGGMGI VGLGSPASQI SSDVVSKNST  300
DTTSPSPVPY IFGRGRKWGA NLEKVVERRQ RRMIKNRESA ARSRARKQAY TLELEAEVAK  360
LKEMNQELLK KQEEMMEMQK NQMLEKVNRP WGRKRQCLRR TITCPW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480226.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform X1
SwissprotQ9M7Q31e-119AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0D2SMH30.0A0A0D2SMH3_G
STRINGPOPTR_0009s10400.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.22e-74abscisic acid responsive elements-binding factor 3